M. Altmann, N. Sonenberg, and H. Trachsel, Translation in Saccharomyces cerevisiae: initiation factor 4E-dependent cell-free system, Mol. Cell Biol, vol.9, pp.4467-4472, 1989.

B. Borgstrøm and I. E. Johansen, Mutations in Pea seedborne mosaic virus genomelinked protein VPg alter pathotype-specific virulence in Pisum sativum, Mol. Plant Microbe Interact, vol.14, pp.707-714, 2001.

K. S. Browning, Plant translation initiation factors: it is not easy to be green, Biochem Soc Trans, vol.32, pp.589-591, 2004.

C. Caranta and A. Palloix, Both common and specific genetic factors are involved in polygenic resistance of pepper to several potyviruses, Theor. Appl. Genet, vol.92, pp.15-20, 1996.
URL : https://hal.archives-ouvertes.fr/hal-02693780

J. P. Combe, M. E. Petracek, G. Van-eldik, F. Meulewaeter, and D. Twell, Translation initiation factors eIF4E and eIFiso4E are required for polysome formation and regulate plant growth in tobacco, Plant Mol. Biol, vol.57, pp.749-760, 2005.

B. Culjkovic, I. Topisirovic, and K. L. Borden, Controlling gene expression through RNA regulons: the role of the eukaryotic translation initiation factor eIF4E, Cell Cycle, vol.6, pp.65-69, 2007.

C. M. Deom and X. Z. He, Second-site reversion of a dysfunctional mutation in a conserved region of the Tobacco mosaic tobamovirus movement protein, Virology, vol.232, pp.13-18, 1997.

P. N. Dodds, G. J. Lawrence, A. M. Catanzariti, T. Teh, C. I. Wang et al., Direct protein interaction underlies gene-for-gene specificity and coevolution of the flax resistance genes and flax rust avirulence genes, Proc Natl Acad Sci U S A, vol.103, pp.8888-8893, 2006.

A. Duprat, C. Caranta, F. Revers, B. Menand, K. S. Browning et al., The Arabidopsis eukaryotic initiation factor (iso)4E is dispensable for plant growth but required for susceptibility to potyviruses, Plant J, vol.32, pp.927-934, 2002.
URL : https://hal.archives-ouvertes.fr/hal-02673279

T. M. Fulton, J. Chunwongse, and S. Tanksley, Microprep protocol for extraction of DNA from tomato and other Herbaceous plants, Plant Molecular Biology Reporter, vol.13, pp.207-209, 1995.

D. Gallie and K. Browning, eIF4G functionally differs from eIF(iso)4G in promoting internal initiation, cap-independant translation and tranlation of structured mRNAs, J. Biol. Chem, vol.276, pp.36951-36960, 2001.

L. Albar, M. Bangratz-reyser, E. Hebrard, M. N. Ndjiondjop, M. Jones et al., Mutations in the eIF(iso)4G translation initiation factor confer high resistance of rice to Rice yellow mottle virus, Plant J, vol.47, pp.417-426, 2006.
URL : https://hal.archives-ouvertes.fr/hal-00164214

M. Altmann, N. Sonenberg, and H. Trachsel, Translation in Saccharomyces cerevisiae: initiation factor 4E-dependent cell-free system, Mol. Cell Biol, vol.9, pp.4467-4472, 1989.

M. Altmann and H. Trachsel, Translation initiation factor-dependent extracts from yeast Saccharomyces cerevisiae, Methods, vol.11, pp.343-352, 1997.

A. Amiri, B. D. Keiper, I. Kawasaki, Y. Fan, Y. Kohara et al., An isoform of eIF4E is a component of germ granules and is required for spermatogenesis in C. elegans, Development, vol.128, pp.3899-3912, 2001.

M. A. Aranda, M. Escaler, D. Wang, and A. J. Maule, Induction of HSP70 and polyubiquitin expression associated with plant virus replication, Proc. Natl. Acad. Sci U S A, vol.93, pp.15289-15293, 1996.

I. Ariyaratne, H. A. Hobbs, R. A. Valverde, L. L. Black, and P. J. Dufresne, Resistance of Capsicum spp. genotypes to Tobacco etch potyvirus isolates from Western hemisphere, Plant disease, vol.80, pp.1257-1261, 1996.

M. Arteaga and R. G. Ortega, Biological characterization of PVY as isolated from pepper in Spain, VIth Eucapria Meeting on Genetics and Bredding on Capsicum and Eggplant, pp.183-188, 1986.

T. Ashfield, L. E. Ong, K. Nobuta, C. M. Schneider, and R. W. Innes, Convergent evolution of disease resistance gene specificity in two flowering plant families, Plant Cell, vol.16, pp.309-318, 2004.

V. Ayme, Mécanismes de contournement des résistances et évaluation a priori de leur durabilité dans l'interaction piment (Capsicum annuum) -Virus Y de la pomme de terre (PVY), Sciences et techniques du Languedoc, p.130, 2005.

V. Ayme, S. Souche, C. Caranta, M. Jacquemond, J. Chadoeuf et al., Different mutations in the genome-linked protein VPg of Potato virus Y confer virulence on the pvr2 3 resistance in pepper, Mol Plant Microbe Interact, vol.19, pp.557-563, 2006.

E. G. Bakker, C. Toomajian, M. Kreitman, and J. Bergelson, A genome-wide survey of R gene polymorphisms in Arabidopsis, Plant Cell, vol.18, pp.1803-1818, 2006.

M. Bamshad and S. P. Wooding, Signatures of natural selection in the human genome, Nat Rev Genet, vol.4, pp.99-111, 2003.

D. C. Baulcombe, S. Chapman, S. Cruz, and S. , Jellyfish green fluorescent protein as a reporter for virus infections, Plant J, vol.7, pp.1045-1053, 1995.

D. A. Baunoch, P. Das, M. E. Browning, and V. Hari, A temporal study of the expression of the capsid, cytoplasmic inclusion and nuclear inclusion proteins of Tobacco etch potyvirus in infected plants, J. Gen. Virol, vol.72, pp.487-492, 1991.

C. Beauchemin, N. Boutet, and J. F. Laliberte, Visualisation of the interaction between the precursors of the viral protein linked to the genome (VPg) of Turnip mosaic virus and the translation eukaryotic initiation factor iso4E in planta, J Virol, 2006.

J. Bergelson, M. Kreitman, E. A. Stahl, and D. Tian, Evolutionary dynamics of plant R-genes, Science, vol.292, pp.2281-2285, 2001.

S. Berger, T. Mitchell-olds, and H. U. Stotz, Local and differential control of vegetative storage protein expression in response to herbivore damage in Arabidopsis thaliana, Physiol Plant, vol.114, pp.85-91, 2002.

X. Bi, J. Ren, and D. J. Goss, Wheat germ translation initiation factor eIF4B affects eIF4A and eIFiso4F helicase activity by increasing the ATP binding affinity of eIF4A, Biochemistry, vol.39, pp.5758-5765, 2000.

L. S. Boiteux, F. P. Cupertino, C. Silva, A. N. Dusi, D. C. Monte-neshich et al., Resistance to Potato virus Y (pathotype 1-2) in Capsicum annuum and Capsicum chinense is controlled by two independent major genes, Euphytica, vol.87, pp.53-58, 1996.

C. L. Bokros, J. D. Hugdahl, H. H. Kim, V. R. Hanesworth, A. Van-heerden et al., Function of the p86 subunit of eukaryotic initiation factor (iso)4F as a microtubule-associated protein in plant cells, Proc. Natl. Acad. Sci. U S A, vol.92, pp.7120-7124, 1995.

B. Borgstrom and I. E. Johansen, Mutations in Pea seedborne mosaic virus genomelinked protein VPg alter pathotype-specific virulence in Pisum sativum, Mol. Plant Microbe Interact, vol.14, pp.707-714, 2001.

M. A. Botella, J. E. Parker, L. N. Frost, P. D. Bittner-eddy, J. L. Beynon et al., Three genes of the Arabidopsis RPP1 complex resistance locus recognize distinct Peronospora parasitica avirulence determinants, Plant Cell, vol.10, pp.1847-1860, 1998.

K. Bracha-drori, K. Shichrur, A. Katz, M. Oliva, R. Angelovici et al., Detection of protein-protein interactions in plants using bimolecular fluorescence complementation, Plant J, vol.40, pp.419-427, 2004.

K. S. Browning, The plant translational apparatus, Plant Mol Biol, vol.32, pp.107-144, 1996.

K. S. Browning, Plant translation initiation factors: it is not easy to be green, Biochem Soc Trans, vol.32, pp.589-591, 2004.

K. S. Browning, S. R. Lax, and J. M. Ravel, Identification of two messenger RNA cap binding proteins in wheat germ. Evidence that the 28-kDa subunit of eIF-4B and the 26-kDa subunit of eIF-4F are antigenically distinct polypeptides, J. Biol. Chem, vol.262, pp.11228-11232, 1987.

K. S. Browning, C. Webster, J. K. Roberts, and J. M. Ravel, Identification of an isozyme form of protein synthesis initiation factor 4F in plants, J. Biol. Chem, vol.267, pp.10096-10100, 1992.

M. Brun-rasmussen, I. Moller, G. Tulinius, J. Hansen, O. Lund et al., The same allele of translation initiation factor 4E mediates resistance against two Potyvirus spp. in Pisum sativum, Mol Plant Microbe Interact, vol.20, pp.1075-1082, 2007.

A. L. Caicedo, B. A. Schaal, and B. N. Kunkel, Diversity and molecular evolution of the RPS2 resistance gene in Arabidopsis thaliana, Proc Natl Acad Sci U S A, vol.96, pp.302-306, 1999.

C. Caranta, V. Lefebvre, and A. Palloix, Polygenic resistance of pepper to potyviruses consists of a combination of isolate-specific and broad-spectrum quantitative trait loci, Mol. Plant Microbe Interact, vol.10, pp.872-878, 1997.
URL : https://hal.archives-ouvertes.fr/hal-02685033

C. Caranta, A. Palloix, K. Gebre-selassie, V. Lefebvre, B. Moury et al., A complementation of two genes originating from susceptible Capsicum annuum lines confers a new and complete resistance to Pepper veinal mottle virus, Phytopathol, vol.86, pp.739-743, 1996.
URL : https://hal.archives-ouvertes.fr/hal-02696956

S. E. Carberry, E. Darzynkiewicz, and D. J. Goss, A comparison of the binding of methylated cap analogues to wheat germ protein synthesis initiation factors 4F and (iso)4F. Biochemistry, vol.30, pp.1624-1627, 1991.

J. Carrington and D. Freed, Cap-independent enhancement of translation by a plant potyvirus 5' nontranslated region, J. Virol, vol.64, pp.1590-1597, 1990.

J. Carrington, K. Kaschau, S. Mahajan, and M. Schaad, Cell-to-cell and long distance transport of viruses in plants, Plant Cell, vol.8, pp.1669-1681, 1996.

D. Charlesworth, B. Charlesworth, and G. A. Mcvean, Genome sequences and evolutionary biology, a two-way interaction, Trends Ecol Evol, vol.16, pp.235-242, 2001.

C. Charron, Rôle du facteur d'initiation de la traduction eIF4E dans la résistance aux potyvirus chez les Solanacées : diversité allélique et études d'expression, p.19, 2004.

P. Chiemsombat, N. Sae-ung, S. Attathom, S. Patarapuwadol, and P. Siriwong, Molecular taxonomy of a new potyvirus isolated from chilli pepper in Thailand, Arch Virol, vol.143, pp.1855-1863, 1998.

P. F. Cho, F. Poulin, Y. A. Cho-park, I. B. Cho-park, J. D. Chicoine et al., A new paradigm for translational control: inhibition via 5'-3' mRNA tethering by Bicoid and the eIF4E cognate 4EHP, Cell, vol.121, pp.411-423, 2005.

M. Clark and A. Adams, Characteristics of the microplate method of enzym-linked immunosorbent assay for the detection of plant virus, J. Gen. Virol, vol.34, pp.475-483, 1977.

M. J. Clemens and U. A. Bommer, Translational control: the cancer connection, Int J Biochem Cell Biol, vol.31, pp.1-23, 1999.

T. Colbert, B. J. Till, R. Tompa, S. Reynolds, M. N. Steine et al., High-throughput screening for induced point mutations, Plant Physiol, vol.126, pp.480-484, 2001.

B. C. Couch, R. Spangler, C. Ramos, and G. May, Pervasive purifying selection characterizes the evolution of I2 homologs, Mol Plant Microbe Interact, vol.19, pp.288-303, 2006.

B. Culjkovic, I. Topisirovic, and K. L. Borden, Controlling gene expression through RNA regulons: the role of the eukaryotic translation initiation factor eIF4E, Cell Cycle, vol.6, pp.65-69, 2007.

B. Culjkovic, I. Topisirovic, L. Skrabanek, M. Ruiz-gutierrez, and K. L. Borden, ) eIF4E promotes nuclear export of cyclin D1 mRNAs via an element in the 3'UTR, J. Cell Biol, vol.169, pp.245-256, 2005.

J. L. Dangl and J. D. Jones, Plant pathogens and integrated defence responses to infection, Nature, vol.411, pp.826-833, 2001.

R. Dawkins and J. R. Krebs, Arms races between and within species, Proc R Soc Lond B Biol Sci, vol.205, pp.489-511, 1979.

J. De-meaux and T. Mitchell-olds, Evolution of plant resistance at the molecular level: ecological context of species interactions, Heredity, vol.91, pp.345-352, 2003.

V. Decroocq, O. Sicard, J. M. Alamillo, M. Lansac, J. P. Eyquard et al., Multiple resistance traits control Plum pox virus infection in Arabidopsis thaliana, Mol Plant Microbe Interact, vol.19, pp.541-549, 2006.
URL : https://hal.archives-ouvertes.fr/hal-02663464

C. Delye, C. Straub, S. Michel, and V. Le-corre, Nucleotide variability at the acetyl coenzyme A carboxylase gene and the signature of herbicide selection in the grass weed Alopecurus myosuroides (Huds.), Mol Biol Evol, vol.21, pp.884-892, 2004.
URL : https://hal.archives-ouvertes.fr/hal-02673623

C. M. Deom and X. Z. He, Second-site reversion of a dysfunctional mutation in a conserved region of the Tobacco mosaic tobamovirus movement protein, Virology, vol.232, pp.13-18, 1997.

C. Deulvot, La résistance de l'aubergine aux virus ToMV et PVY : déterminisme génétique et cartographie comparée chez les Solanacées, p.52, 2002.

J. A. Diaz, C. Nieto, E. Moriones, V. Truniger, and M. A. Aranda, Molecular characterization of a Melon necrotic spot virus strain that overcomes the resistance in melon and nonhost plants, Mol. Plant Microbe Interact, vol.17, pp.668-675, 2004.

J. Diaz-pendon, V. Truninger, C. Nieto, J. Garcia-mas, A. Bendahmane et al., Advances in understanding recessive resistance to plant viruses, Mol. Plant Pathol, vol.5, pp.223-233, 2004.
URL : https://hal.archives-ouvertes.fr/hal-02682496

C. Dijan-caporalino, V. Lefebvre, . Sage-palloix, and A. Palloix, Genetic resources, chromosome engineering, and crop improvement, 2006.

J. Ding, H. Cheng, X. Jin, H. Araki, Y. Yang et al., Contrasting patterns of evolution between allelic groups at a single locus in Arabidopsis, Genetica, vol.129, pp.235-242, 2007.

T. D. Dinkova, B. D. Keiper, N. L. Korneeva, E. J. Aamodt, and R. E. Rhoads, Translation of a small subset of Caenorhabditis elegans mRNAs is dependent on a specific eukaryotic translation initiation factor 4E isoform, Mol. Cell Biol, vol.25, pp.100-113, 2005.

M. S. Dixon, K. Hatzixanthis, D. A. Jones, K. Harrison, and J. D. Jones, The tomato Cf-5 disease resistance gene and six homologs show pronounced allelic variation in leucine-rich repeat copy number, Plant Cell, vol.10, pp.1915-1925, 1998.

P. N. Dodds, G. J. Lawrence, A. J. Pryor, and J. G. Ellis, Molecular Plant Pathology. Sheffield Academic, pp.88-107, 2000.

J. W. Drake and J. J. Holland, Mutation rates among RNA viruses, Proc. Natl. Acad. Sci. U S A, vol.96, pp.13910-13913, 1999.

A. Duprat, Contribution à l'étude des facteurs d'initiation de la traduction eIF4E chez Arabidopsis thaliana, p.110, 2002.

J. G. Ellis, P. N. Dodds, and G. J. Lawrence, Flax rust resistance gene specificity is based on direct resistance-avirulence protein interactions, Annu Rev Phytopathol, 2007.

J. G. Ellis, G. J. Lawrence, J. E. Luck, and P. N. Dodds, Identification of regions in alleles of the flax rust resistance gene L that determine differences in gene-for-gene specificity, Plant Cell, vol.11, pp.495-506, 1999.

G. Farnham and D. C. Baulcombe, Artificial evolution extends the spectrum of viruses that are targeted by a disease-resistance gene from potato, Proc. Natl. Acad. Sci U S A, vol.103, pp.18828-18833, 2006.

J. C. Fay and C. I. Wu, Hitchhiking under positive Darwinian selection, Genetics, vol.155, pp.1405-1413, 2000.

M. A. Ferraiuolo, S. Basak, J. Dostie, E. L. Murray, D. R. Schoenberg et al., A role for the eIF4E-binding protein 4E-T in P-body formation and mRNA decay, J Cell Biol, vol.170, pp.913-924, 2005.

H. H. Flor, Current status of the gene for gene concept, Ann. Rev. Phytopathol, vol.9, pp.275-296, 1971.

R. Fraser, The genetics of resistance to plant viruses, Annu. Rev. Phytopathol, vol.28, pp.179-200, 1990.

R. French and D. C. Stenger, Evolution of Wheat streak mosaic virus: dynamics of population growth within plants may explain limited variation, Annu Rev Phytopathol, vol.41, pp.199-214, 2003.

C. Fribourg, Host plant reactions, some properties, and serology of Peru tomato virus, Phytopathology, vol.69, pp.441-445, 1979.

Y. X. Fu and W. H. Li, Statistical tests of neutrality of mutations, Genetics, vol.133, pp.693-709, 1993.

T. M. Fulton, J. Chunwongse, and S. Tanksley, Microprep protocol for extraction of DNA from tomato and other Herbaceous plants, Plant Molecular Biology Reporter, vol.13, pp.207-209, 1995.

D. Gallie, Protein-protein interactions during translation, Plant Mol. Biol, vol.50, pp.949-970, 2002.

D. Gallie and K. Browning, eIF4G functionally differs from eIF(iso)4G in promoting internal initiation, cap-independant translation and translation of structured mRNAs, J. Biol. Chem, vol.276, pp.36951-36960, 2001.

D. Gallie, H. Le, R. Tanguay, and K. Browning, Translation initiation factors are differentially regulated in cereals during development and following heat shock, Plant J, vol.14, pp.715-722, 1998.

Z. Gao, S. Eyers, C. Thomas, N. Ellis, and A. Maule, Identification of markers tightly linked to sbm recessive genes for resistance to Pea seed-borne mosaic virus, Theor. Appl. Genet, vol.109, pp.488-494, 2004.

Z. Gao, E. Johansen, S. Eyers, C. Thomas, T. Ellis et al., The potyvirus recessive resistance gene, sbm1, identifies a novel role for translation initiation factor eIF4E in cell-to-cell trafficking, Plant J, vol.40, pp.376-385, 2004.

G. Sélassié, K. Marchoux, G. Delecolle, B. Pochard, and E. , Variabilité naturelle des souches de virus Y de la pomme de terre dans les cultures de piment du Sud-Est de la France. Caractérisation et classification en pathotypes, vol.5, pp.621-630, 1985.

L. Glais, M. Tribodet, and C. Kerlan, Genomic variability in Potato potyvirus Y (PVY): evidence that PVY(N)W and PVY(NTN) variants are single to multiple recombinants between PVY(O) and PVY(N) isolates, Arch Virol, vol.147, pp.363-378, 2002.

N. Goldman and Z. Yang, A codon-based model of nucleotide substitution for protein-coding DNA sequences, Mol Biol Evol, vol.11, pp.725-736, 1994.

G. W. Gordon, G. Berry, X. H. Liang, B. Levine, and B. Herman, Quantitative fluorescence resonance energy transfer measurements using fluorescence microscopy, Biophys. J, vol.74, pp.2702-2713, 1998.

S. K. Green and J. S. Kim, Characteristics and control of viruses infecting peppers: a litterature review. Asian Vegetable and Development Center, Technical Bulletin, vol.18, p.60, 1991.

W. H. Greenleaf, Breeding vegetable crops, pp.67-134, 1986.

J. D. Gross, N. J. Moerke, T. Haar, A. A. Lugovskoy, A. B. Sachs et al., Ribosome loading onto the mRNA cap is driven by conformational coupling between eIF4G and eIF4E, Cell, vol.115, pp.739-750, 2003.

R. Grzela, L. Strokovska, J. P. Andrieu, B. Dublet, W. Zagorski et al., Potyvirus terminal protein VPg, effector of host eukaryotic initiation factor eIF4E, Biochimie, vol.88, pp.887-896, 2006.

M. Guerini and J. Murphy, Resistance of Capsicum annuum 'Avelar' to pepper mottle potyvirus and alleviation of this resistance by co-infection with Cucumber mosaic cucumovirus are associated with virus movement, J. Gen. Virol, vol.80, pp.2785-2792, 1999.

T. A. Hall, BioEdit: a user-friendly biological sequence alignment editor and analysis program for windows 95/98/NT, Nucl. Acids Symp. Ser, vol.41, pp.95-98, 1999.

J. H. Hamalainen, T. Kekarainen, C. Gebhardt, K. N. Watanabe, and J. P. Valkonen, Recessive and dominant genes interfere with the vascular transport of Potato virus A in diploid potatoes, Mol. Plant Microbe Interact, vol.13, pp.402-412, 2000.

Z. Havelda and A. J. Maule, Complex spatial responses to Cucumber mosaic virus infection in susceptible Cucurbita pepo cotyledons, Plant Cell, vol.12, pp.1975-1986, 2000.

E. Hebrard, Les VPgs, des protéines toutes désordonnées. 11 èmes Rencontres de Virologie Végétale, du 28 janvier au 1 er février, 2007.

E. Hebrard, A. Pinel-galzi, A. Bersoult, C. Sire, and D. Fargette, Emergence of a resistance-breaking isolate of Rice yellow mottle virus during serial inoculations is due to a single substitution in the genome-linked viral protein VPg, J Gen Virol, vol.87, pp.1369-1373, 2006.
URL : https://hal.archives-ouvertes.fr/hal-01522142

G. Hernandez, M. Altmann, J. M. Sierra, H. Urlaub, R. Diez-del-corral et al., Functional analysis of seven genes encoding eight translation initiation factor 4E (eIF4E) isoforms in Drosophila, Mech. Dev, vol.122, pp.529-543, 2005.

J. Herold and R. Andino, Poliovirus RNA replication requires genome circularization through a protein-protein bridge, Mol. Cell, vol.7, pp.581-591, 2001.

J. A. Hiscox, The interaction of animal cytoplasmic RNA viruses with the nucleus to facilitate replication, Virus Res, vol.95, pp.13-22, 2003.

E. B. Holub, The arms race is ancient history in Arabidopsis, the wildflower, Nat Rev Genet, vol.2, pp.516-527, 2001.

Y. Hong, K. Levay, J. F. Murphy, P. G. Klein, J. G. Shaw et al., A potyvirus polymerase interacts with the viral coat protein and VPg in yeast cells, Virology, vol.214, pp.159-166, 1995.

R. R. Hudson and N. L. Kaplan, The coalescent process in models with selection and recombination, Genetics, vol.120, pp.831-840, 1988.

R. R. Hudson, M. Kreitman, and M. Aguade, A test of neutral molecular evolution based on nucleotide data, Genetics, vol.116, pp.153-159, 1987.

J. M. Hughes, M. Ptushkina, M. M. Karim, N. Koloteva, T. Von-der-haar et al., Translational repression by human 4E-BP1 in yeast specifically requires human eIF4E as target, J Biol Chem, vol.274, pp.3261-3264, 1999.

F. Iborra, D. Jackson, and P. Cook, Coupled transcription and translation within nuclei of mammalian cells, Science, vol.293, pp.1139-1142, 2001.

R. W. Innes, S. R. Bisgrove, N. M. Smith, A. F. Bent, B. J. Staskawicz et al., Identification of a disease resistance locus in Arabidopsis that is functionally homologous to the RPG1 locus of soybean, Plant J, vol.4, pp.813-820, 1993.

R. Jensen, M. Mcleod, W. Eshbaugh, and S. Guttman, Numerical taxonomic analyses of allozymic variation in Capsicum (Solanaceae), Taxon, vol.28, pp.315-327, 1979.

I. E. Johansen, O. S. Lund, C. K. Hjulsager, and J. Laursen, Recessive resistance in Pisum sativum and potyvirus pathotype resolved in a gene-for-cistron correspondence between host and virus, J. Virol, vol.75, pp.6609-6614, 2001.

R. Johnson, The concept of durable resistance, Phytopathol, vol.69, pp.198-199, 1979.

R. Johnson, Durable resistance: definition of, genetic control and attainment in plant breeding, Phytopathol, vol.71, pp.567-568, 1981.

J. D. Jones, Putting knowledge of plant disease resistance genes to work, Curr Opin Plant Biol, vol.4, pp.281-287, 2001.

J. D. Jones and J. L. Dangl, The plant immune system, Nature, vol.444, pp.323-329, 2006.

B. Joshi, K. Lee, D. L. Maeder, and R. Jagus, Phylogenetic analysis of eIF4E-family members, BMC Evol. Biol, vol.5, p.48, 2005.

B. C. Kang, I. Yeam, J. D. Frantz, J. F. Murphy, and M. M. Jahn, The pvr1 locus in Capsicum encodes a translation initiation factor eIF4E that interacts with Tobacco etch virus VPg, Plant J, vol.42, pp.392-405, 2005.

B. C. Kang, I. Yeam, and M. M. Jahn, Genetics of plant virus resistance, Annu Rev Phytopathol, vol.43, pp.581-621, 2005.

K. Kanyuka, G. Mcgrann, K. Alhudaib, D. Hariri, and M. J. Adams, Biological and sequence analysis of a novel European isolate of Barley mild mosaic virus that overcomes the barley rym5 resistance gene, Arch Virol, vol.149, pp.1469-1480, 2004.
URL : https://hal.archives-ouvertes.fr/hal-02678197

B. Keiper, B. Lamphear, A. Deshpande, M. Jankowska-anyszka, E. Aamodt et al., Functional characterization of five eIF4E isoforms in Caenorhabditis elegans, J. Biol. Chem, vol.275, pp.10590-10596, 2000.

M. Kimura, Rare variant alleles in the light of the neutral theory, Mol Biol Evol, vol.1, pp.84-93, 1983.

M. Kozak, The scanning model for translation: an update, J. Cell Biol, vol.108, pp.229-241, 1989.

T. Kühne, N. Shi, G. Proeseler, M. J. Adams, and K. Kanyuka, The ability of a bymovirus to overcome the rym4-mediated resistance in barley correlates with a codon change in the VPg coding region on RNA1, J. Gen. Virol, vol.84, pp.2853-2859, 2003.

S. Kumar, K. Tamura, and M. Nei, MEGA3: Integrated software for Molecular Evolutionary Genetics Analysis and sequence alignment, Brief Bioinform, vol.5, pp.150-163, 2004.

B. N. Kunkel, A useful weed put to work: genetic analysis of disease resistance in Arabidopsis thaliana, Trends Genet, vol.12, pp.63-69, 1996.

D. Kushner, B. Lindenbach, V. Grdzelishvili, A. Noueiry, S. Paul et al., Systematic, genome-wide identification of host genes affecting replication of a positive-strand RNA virus, Proc. Natl. Acad. Sci. U S A, vol.100, pp.15764-15769, 2003.

M. M. Kyle and A. Palloix, Proposed revision of nomenclature for potyvirus resistance genes in Capsicum, Euphytica, vol.97, pp.183-188, 1997.
URL : https://hal.archives-ouvertes.fr/hal-02689840

A. Labay, Toward the characterisation of the molecular basis for the specificity in the utilization of eIF4E proteins by potyviruses, p.20, 2007.

H. K. Lai and K. L. Borden, The promyelocytic leukemia (PML) protein suppresses cyclin D1 protein production by altering the nuclear cytoplasmic distribution of cyclin D1 mRNA, Oncogene, vol.19, pp.1623-1634, 2000.

S. Lall, C. C. Friedman, M. Jankowska-anyszka, J. Stepinski, E. Darzynkiewicz et al., Contribution of trans-splicing, 5' -leader length, cap-poly(A) synergism, and initiation factors to nematode translation in an embryo cell-free system, J. Biol. Chem, vol.279, pp.45573-45585, 2004.

C. Lavoie, P. Lachance, N. Sonenberg, and P. Lasko, Alternatively spliced transcripts from the Drosophila eIF4E gene produce two different cap-binding proteins, J. Biol. Chem, vol.271, pp.16393-16398, 1996.

S. Lax, W. Fritz, K. Browning, and J. Ravel, Isolation and characterization of factors from wheat germ that exhibit eukaryotic initiation factor 4B activity and overcome 7-methylguanosine 5'-triphosphate inhibition of polypeptide synthesis, Proc. Natl. Acad. Sci. U S A, vol.82, pp.330-333, 1985.

H. Le, R. Tanguay, M. Balasta, C. Wei, K. Browning et al., Translation initiation factors eIF-iso4G and eIF-4B interact with the poly(A)-binding protein and increase its RNA binding activity, J. Biol. Chem, vol.272, pp.16247-16255, 1997.

A. Lellis, K. Kasschau, S. Whitham, and J. Carrington, Loss-of-susceptibility mutants of Arabidopsis thaliana reveal an essential role for eIF(iso)4E during potyvirus infection, Curr. Biol, vol.12, pp.1046-1051, 2002.

T. Lenormand, D. Bourguet, T. Guillemaud, and M. Raymond, Tracking the evolution of insecticide resistance in the mosquito Culex pipiens, Nature, vol.400, pp.861-864, 1999.
URL : https://hal.archives-ouvertes.fr/hal-02691471

T. Lenormand and M. Raymond, Analysis of Clines with Variable Selection and Variable Migration, Am. Nat, vol.155, pp.70-82, 2000.

S. Leonard, J. Chisholm, J. F. Laliberte, and H. Sanfacon, Interaction in vitro between the proteinase of Tomato ringspot virus (genus Nepovirus) and the eukaryotic translation initiation factor iso4E from Arabidopsis thaliana, J. Gen. Virol, vol.83, pp.2085-2089, 2002.

S. Leonard, D. Plante, S. Wittmann, N. Daigneault, M. G. Fortin et al., Complex formation between potyvirus VPg and translation eukaryotic initiation factor 4E correlates with virus infectivity, J Virol, vol.74, pp.7730-7737, 2000.

S. Leonard, C. Viel, C. Beauchemin, N. Daigneault, M. G. Fortin et al., Interaction of VPg-Pro of Turnip mosaic virus with the translation initiation factor 4E and the poly(A)-binding protein in planta, J Gen Virol, vol.85, pp.1055-1063, 2004.

J. Li, A. P. Hsia, and P. S. Schnable, Recent advances in plant recombination, Curr Opin Plant Biol, vol.10, pp.131-135, 2007.

W. H. Li, C. I. Wu, and C. C. Luo, A new method for estimating synonymous and nonsynonymous rates of nucleotide substitution considering the relative likelihood of nucleotide and codon changes, Mol Biol Evol, vol.2, pp.150-174, 1985.

J. E. Luck, G. J. Lawrence, P. N. Dodds, K. W. Shepherd, and J. G. Ellis, Regions outside of the leucine-rich repeats of flax rust resistance proteins play a role in specificity determination, Plant Cell, vol.12, pp.1367-1377, 2000.

Y. Luo and D. Goss, Homeostasis in mRNA initiation: wheat germ poly(A)-binding protein lowers the activation energy barrier to initiation complex formation, J. Biol. Chem, vol.276, pp.43083-43086, 2001.

J. M. Malpica, A. Fraile, I. Moreno, C. I. Obies, J. W. Drake et al., The rate and character of spontaneous mutation in an RNA virus, Genetics, vol.162, pp.1505-1511, 2002.

J. Marcotrigiano, A. Gringras, N. Sonenberg, and S. Burley, Co-crystal structure of the messenger RNA 5' cap binding protein (eIF4E) bound to 7-methyl-GDP, Cell, vol.89, pp.951-961, 1997.

H. Matsuo, H. Li, A. M. Mcguire, C. M. Fletcher, A. C. Gingras et al., Structure of translation factor eIF4E bound to m7GDP and interaction with 4E-binding protein, Nat. Struct. Biol, vol.4, pp.717-724, 1997.

A. Maule, C. Caranta, and M. Boulton, Sources of natural resistance to plant viruses: status and prospects, Molecular Plant Pathology, vol.8, pp.223-231, 2007.

A. Maule, V. Leh, and C. Lederer, The dialogue between viruses and hosts in compatible interactions, Curr. Op. Plant Biol, vol.5, pp.279-284, 2002.

R. Mauricio, E. A. Stahl, T. Korves, D. Tian, M. Kreitman et al., Natural selection for polymorphism in the disease resistance gene Rps2 of Arabidopsis thaliana, Genetics, vol.163, pp.735-746, 2003.

J. H. Mcdonald and M. Kreitman, Adaptive protein evolution at the Adh locus in Drosophila, Nature, vol.351, pp.652-654, 1991.

J. M. Mcdowell, M. Dhandaydham, T. A. Long, M. G. Aarts, S. Goff et al., Intragenic recombination and diversifying selection contribute to the evolution of downy mildew resistance at the RPP8 locus of Arabidopsis, Plant Cell, vol.10, pp.1861-1874, 1998.

J. M. Mcdowell and B. J. Woffenden, Plant disease resistance genes: recent insights and potential applications, Trends Biotechnol, vol.21, pp.178-183, 2003.

H. I. Mckhann, C. Camilleri, A. Berard, T. Bataillon, J. L. David et al., Nested core collections maximizing genetic diversity in Arabidopsis thaliana, Plant J, vol.38, pp.193-202, 2004.
URL : https://hal.archives-ouvertes.fr/hal-02673930

Y. Menchari, C. Camilleri, S. Michel, D. Brunel, F. Dessaint et al., Weed response to herbicides: regional-scale distribution of herbicide resistance alleles in the grass weed Alopecurus myosuroides, New Phytol, vol.171, pp.861-873, 2006.
URL : https://hal.archives-ouvertes.fr/hal-02661635

A. Metz, K. Wong, S. Malmstrom, and K. Browning, Eukaryotic initiation factor 4B from wheat and Arabidopsis thaliana is a member of a multigene family, Biochem. Biophys. Res. Commun, vol.266, pp.314-321, 1999.

B. C. Meyers, A. W. Dickerman, R. W. Michelmore, S. Sivaramakrishnan, B. W. Sobral et al., Plant disease resistance genes encode members of an ancient and diverse protein family within the nucleotide-binding superfamily, Plant J, vol.20, pp.317-332, 1999.

B. C. Meyers, A. Kozik, A. Griego, H. Kuang, and R. W. Michelmore, Genome-wide analysis of NBS-LRR-encoding genes in Arabidopsis, Plant Cell, vol.15, pp.809-834, 2003.

T. Michon, Y. Estevez, J. Walter, S. German-retana, L. Gall et al., The potyviral virus genome-linked protein VPg forms a ternary complex with the eukaryotic initiation factors eIF4E and eIF4G and reduces eIF4E affinity for a mRNA cap analogue, Febs J, vol.273, pp.1312-1322, 2006.
URL : https://hal.archives-ouvertes.fr/hal-02666307

J. Miller and S. Tanksley, RFLP analysis of phylogenetic relationships and genetiv variation in the genus Lycopersicon, Theor Appl Genet, vol.80, pp.437-448, 1990.

H. Miyoshi, N. Suehiro, K. Tomoo, S. Muto, T. Takahashi et al., Binding analyses for the interaction between plant virus genomelinked protein (VPg) and plant translational initiation factors, Biochimie, 2005.

A. F. Monzingo, S. Dhaliwal, A. Dutt-chaudhuri, A. Lyon, J. H. Sadow et al., The structure of eukaryotic translation initiation factor-4E from wheat reveals a novel disulfide bond, Plant Physiol, vol.143, pp.1504-1518, 2007.

C. Morel, Recherche des déterminants moléculaires du virus Y de la pomme de terre (PVY) impliqués dans le contournement de résistance de Lycopersicon hirsutum, Université Rennes, vol.1, p.343, 2000.

B. Moury, C. Desbiez, M. Jacquemond, and H. Lecoq, Genetic diversity of plant virus populations: towards hypothesis testing in molecular epidemiology, Adv Virus Res, vol.67, pp.49-87, 2006.
URL : https://hal.archives-ouvertes.fr/hal-02667830

B. Moury, C. Morel, E. Johansen, L. Guilbaud, S. Souche et al., Mutations in Potato virus Y genome-linked protein determine virulence toward recessive resistances in Capsicum annuum and Lycopersicon hirsutum, Mol. Plant Microbe Interact, vol.17, pp.322-329, 2004.
URL : https://hal.archives-ouvertes.fr/hal-02682733

B. Moury, C. Morel, E. Johansen, and M. Jacquemond, Evidence for diversifying selection in Potato virus Y and in the coat protein of other potyviruses, J Gen Virol, vol.83, pp.2563-2573, 2002.
URL : https://hal.archives-ouvertes.fr/hal-02680658

M. Nei and T. Gojobori, Simple methods for estimating the numbers of synonymous and nonsynonymous nucleotide substitutions, Mol Biol Evol, vol.3, pp.418-426, 1986.

M. Nei and W. H. Li, Mathematical model for studying genetic variation in terms of restriction endonucleases, Proc Natl Acad Sci U S A, vol.76, pp.5269-5273, 1979.

M. Nelson, R. Wheeler, and T. Zitter, Pepper mottle virus. CMI/AAB Description Plant viruses, p.253, 1982.

T. C. Nesbitt and S. D. Tanksley, Comparative sequencing in the genus Lycopersicon. Implications for the evolution of fruit size in the domestication of cultivated tomatoes, Genetics, vol.162, pp.365-379, 2002.

V. Nicaise, Etude des facteurs cellulaires impliqués dans les interactions plante-virus : rôle du facteur d'initiation de la traduction 4E (eIF4E), vol.2, p.166, 2006.

V. Nicaise, J. L. Gallois, F. Chafiai, L. M. Allen, V. Schurdi-levraud et al., Coordinated and selective recruitment of eIF4E and eIF4G factors for potyvirus infection in Arabidopsis thaliana, FEBS Lett, vol.581, pp.1041-1046, 2007.
URL : https://hal.archives-ouvertes.fr/hal-02663052

V. Nicaise, S. German-retana, R. Sanjuan, M. P. Dubrana, M. Mazier et al., The eukaryotic translation initiation factor 4E controls lettuce susceptibility to the potyvirus Lettuce mosaic virus, Plant Physiol, vol.132, pp.1272-1282, 2003.
URL : https://hal.archives-ouvertes.fr/hal-02679237

O. Nicolas, S. W. Dunnington, L. F. Gotow, T. P. Pirone, and G. M. Hellmann, Variations in the VPg protein allow a potyvirus to overcome va gene resistance in tobacco, Virology, vol.237, pp.452-459, 1997.

N. Nicot, J. F. Hausman, L. Hoffmann, and D. Evers, Housekeeping gene selection for real-time RT-PCR normalization in potato during biotic and abiotic stress, J Exp Bot, vol.56, pp.2907-2914, 2005.

R. Nielsen and Z. Yang, Likelihood models for detecting positively selected amino acid sites and applications to the HIV-1 envelope gene, Genetics, vol.148, pp.929-936, 1998.

C. Nieto, M. Morales, G. Orjeda, C. Clepet, A. Monfort et al., An eIF4E allele confers resistance to an uncapped and nonpolyadenylated RNA virus in melon, Plant J, vol.48, pp.452-462, 2006.
URL : https://hal.archives-ouvertes.fr/hal-02662906

L. Noel, T. L. Moores, E. A. Van-der-biezen, M. Parniske, M. J. Daniels et al., Pronounced intraspecific haplotype divergence at the RPP5 complex disease resistance locus of Arabidopsis, Plant Cell, vol.11, pp.2099-2112, 1999.

M. Nordborg, T. T. Hu, Y. Ishino, J. Jhaveri, C. Toomajian et al., The pattern of polymorphism in Arabidopsis thaliana, PLoS Biol, vol.3, p.196, 2005.

C. A. Oleykowski, C. R. Bronson-mullins, A. K. Godwin, and A. T. Yeung, Mutation detection using a novel plant endonuclease, Nucleic Acids Res, vol.26, pp.4597-4602, 1998.

V. Pacaly, Analyse de la résistance au Watermelon mosaic virus et au Cucumber mosaic virus chez Arabidopsis thaliana, p.17, 2006.

V. M. Pain, Initiation of protein synthesis in eukaryotic cells, Eur. J. Biochem, vol.236, pp.747-771, 1996.

A. Palloix, K. Abak, A. M. Daubèze, M. Guldur, and K. Gebre-selassie, Survey of pepper diseases affecting the main production regions of Turkey with special interest in viruses and potyvirus pathotypes, Capsicum and Eggplant Newsletter, vol.13, pp.78-81, 1994.

G. Parrella, S. Ruffel, A. Moretti, C. Morel, A. Palloix et al., Recessive resistance genes against potyviruses are localized in colinear genomic regions of the tomato (Lycopersicon spp.) and pepper (Capsicum spp.) genomes, Theor. Appl. Genet, vol.105, pp.855-861, 2002.
URL : https://hal.archives-ouvertes.fr/hal-02680905

L. Perry, R. Dickau, S. Zarrillo, I. Holst, D. M. Pearsall et al., Starch fossils and the domestication and dispersal of chili peppers (Capsicum spp. L.) in the Americas, Science, vol.315, pp.986-988, 2007.

T. Pestova, S. Borukhov, and C. Hellen, Eukaryotic ribosomes require initiation factors 1 and 1A to locate initiation codons, Nature, vol.394, pp.854-859, 1998.

M. W. Pfaffl, G. W. Horgan, and L. Dempfle, Relative expression software tool (REST) for group-wise comparison and statistical analysis of relative expression results in real-time PCR, Nucleic Acids Res, vol.30, p.36, 2002.

B. Pickersgill, C. Heiser, and J. Mcneill, Numerical taxonomic studies on variation and domestication in some species of Capsicum, The biology and taxonomy of the Solanaceae, pp.679-700, 1979.

R. Provvidenti and R. O. Hampton, Sources of resistance to viruses in the Potyviridae, Arch. Virol. Suppl, vol.5, pp.189-211, 1992.

M. Ptushkina, I. Fierro-monti, J. Van-den-heuvel, S. Vasilescu, R. Birkenhager et al., Schizosaccharomyces pombe has a novel eukaryotic initiation factor 4F complex containing a cap-binding protein with the human eIF4E C-terminal motif KSGST, J. Biol. Chem, vol.271, pp.32818-32824, 1996.

M. Ptushkina, N. Malys, and J. E. Mccarthy, ) eIF4E isoform 2 in Schizosaccharomyces pombe is a novel stress-response factor, EMBO Rep, vol.5, pp.311-316, 2004.

B. Raccah, A. Gal-on, and V. Eastpo, The role of flying aphid vectors in the transmission of Cucumber mosaic virus and Potato virus Y to pepper in Israël, Ann. Appl. Biol, vol.106, pp.451-460, 1985.

M. Rajamäki and J. Valkolen, Viral genome-linked protein (VPg) controls accumulation and phloem-loading of a potyvirus in inoculated potato leaves, Mol. Plant Microbe Interact, vol.15, pp.138-149, 2002.

D. Raoult, S. Audic, C. Robert, C. Abergel, P. Renesto et al., The 1.2-Mb genome sequence of mimivirus, 2004.
URL : https://hal.archives-ouvertes.fr/hal-00651656

M. D. Rausher, Co-evolution and plant resistance to natural enemies, Nature, vol.411, pp.857-864, 2001.

E. Redondo, R. Krause-sakate, S. J. Yang, H. Lot, O. Le-gall et al., Lettuce mosaic virus pathogenicity determinants in susceptible and tolerant lettuce cultivars map to different regions of the viral genome, Mol. Plant Microbe Interact, vol.14, pp.804-810, 2001.
URL : https://hal.archives-ouvertes.fr/hal-02680151

F. Revers, T. Guiraud, M. C. Houvenaghel, T. Mauduit, O. Le-gall et al., Multiple resistance phenotypes to Lettuce mosaic virus among Arabidopsis thaliana accessions, Mol. Plant Microbe Interact, vol.16, pp.608-616, 2003.
URL : https://hal.archives-ouvertes.fr/hal-02671295

F. Revers, O. Le-gall, T. Candresse, M. Le-romancer, and J. Dunez, Frequent occurrence of recombinant potyvirus isolates, J Gen Virol, vol.77, pp.1953-1965, 1996.
URL : https://hal.archives-ouvertes.fr/hal-02687795

F. Revers, O. Le-gall, T. Candresse, and A. Maule, New advances in understanding the molecular biology of plant / potyvirus interactions, Mol. Plant Microbe Interact, vol.12, pp.367-376, 1999.
URL : https://hal.archives-ouvertes.fr/hal-02698068

R. E. Rhoads, T. D. Dinkova, and R. Jagus, Approaches for analyzing the differential activities and functions of eIF4E family members, Methods Enzymol, vol.429, pp.261-297, 2007.

E. Richly, J. Kurth, and D. Leister, Mode of amplification and reorganization of resistance genes during recent Arabidopsis thaliana evolution, Mol Biol Evol, vol.19, pp.76-84, 2002.

A. D. Richman and J. R. Kohn, Self-incompatibility alleles from Physalis: implications for historical inference from balanced genetic polymorphisms, Proc Natl Acad Sci U S A, vol.96, pp.168-172, 1999.

J. D. Richter and N. Sonenberg, Regulation of cap-dependent translation by eIF4E inhibitory proteins, Nature, vol.433, pp.477-480, 2005.

C. M. Rick, Biosystematic studies in Lycopersicon and closely related species of Solanum, pp.667-677, 1979.

C. M. Rick, H. Laterrot, and J. Philouze, A revised key for the Lycopersicon species, Report Tomato Genet. Coop, pp.31-40, 1990.
URL : https://hal.archives-ouvertes.fr/hal-02712754

J. L. Riechmann, S. Lain, and J. A. Garcia, Highlights and prospects of potyvirus molecular biology, J Gen Virol, vol.73, pp.1-16, 1992.

B. K. Riely and G. B. Martin, Ancient origin of pathogen recognition specificity conferred by the tomato disease resistance gene Pto, Proc Natl Acad Sci U S A, vol.98, pp.2059-2064, 2001.

C. Robaglia and C. Caranta, Translation initiation factors: a weak link in plant RNA virus infection, Trends Plant Sci, vol.11, pp.40-45, 2006.
URL : https://hal.archives-ouvertes.fr/hal-02666136

J. Robalino, B. Joshi, S. C. Fahrenkrug, and R. Jagus, Two zebrafish eIF4E family members are differentially expressed and functionally divergent, J. Biol. Chem, vol.279, pp.10532-10541, 2004.

C. Rodriguez, M. Freire, C. Camilleri, and C. Robaglia, The Arabidopsis thaliana cDNAs coding for eIF4E and eIF(iso)4E are not functionally equivalent for yeast complementation and are differentially expressed during plant development, Plant J, vol.13, pp.465-473, 1998.

L. E. Rose, P. D. Bittner-eddy, C. H. Langley, E. B. Holub, R. W. Michelmore et al., The maintenance of extreme amino acid diversity at the disease resistance gene, RPP13, in Arabidopsis thaliana, Genetics, vol.166, pp.1517-1527, 2004.

L. E. Rose, R. W. Michelmore, and C. H. Langley, Natural variation in the Pto disease resistance gene within species of wild tomato (Lycopersicon). II. Population genetics of Pto, Genetics, vol.175, pp.1307-1319, 2007.

K. Roselius, W. Stephan, and T. Stadler, The relationship of nucleotide polymorphism, recombination rate and selection in wild tomato species, Genetics, vol.171, pp.753-763, 2005.

D. Rousseau, A. C. Gingras, A. Pause, and N. Sonenberg, The eIF4E-binding proteins 1 and 2 are negative regulators of cell growth, Oncogene, vol.13, pp.2415-2420, 1996.

F. Roux, S. Giancola, S. Durand, and X. Reboud, Building of an experimental cline with Arabidopsis thaliana to estimate herbicide fitness cost, Genetics, vol.173, pp.1023-1031, 2006.
URL : https://hal.archives-ouvertes.fr/hal-02664262

J. Rozas, J. C. Sanchez-delbarrio, X. Messeguer, and R. Rozas, DnaSP, DNA polymorphism analyses by the coalescent and other methods, Bioinformatics, vol.19, pp.2496-2497, 2003.

S. Ruffel, Résistances récessives aux potyvirus chez les solanacées et facteurs du complexe d'initiation de la traduction, p.159, 2004.

S. Ruffel, C. Caranta, A. Palloix, V. Lefebvre, M. Caboche et al., Structural analysis of the eukaryotic initiation factor 4E gene controlling potyvirus resistance in pepper: exploitation of a BAC library, Gene, vol.338, pp.209-216, 2004.

S. Ruffel, M. H. Dussault, A. Palloix, B. Moury, A. Bendahmane et al., A natural recessive resistance gene against Potato virus Y in pepper corresponds to the eukaryotic initiation factor 4E (eIF4E), Plant J, vol.32, pp.1067-1075, 2002.

S. Ruffel, J. L. Gallois, M. L. Lesage, and C. Caranta, The recessive potyvirus resistance gene pot-1 is the tomato orthologue of the pepper pvr2-eIF4E gene, Mol. Genet. Genomics, pp.1-8, 2005.
URL : https://hal.archives-ouvertes.fr/hal-02678329

S. Ruffel, J. L. Gallois, B. Moury, C. Robaglia, A. Palloix et al., Simultaneous mutations in translation initiation factors eIF4E and eIF(iso)4E are required to prevent Pepper veinal mottle virus infection of pepper, J Gen Virol, vol.87, pp.2089-2098, 2006.

K. Ruud, C. Kuhlow, D. Goss, and K. Browning, Identification and characterization of a novel cap-binding protein from Arabidopsis thaliana, J. Biol. Chem, vol.273, pp.10325-10330, 1998.

S. Sacristan, J. M. Malpica, A. Fraile, and F. Garcia-arenal, Estimation of population bottlenecks during systemic movement of Tobacco mosaic virus in tobacco plants, J Virol, vol.77, pp.9906-9911, 2003.

N. Saitou and M. Nei, The neighbor-joining method: a new method for reconstructing phylogenetic trees, Mol Biol Evol, vol.4, pp.406-425, 1987.

M. Sato, K. Nakahara, M. Yoshii, M. Ishikawa, and I. Uyeda, Selective involvement of members of the eukaryotic initiation factor 4E family in the infection of Arabidopsis thaliana by potyviruses, FEBS Lett, vol.579, pp.1167-1171, 2005.

M. Schaad, R. Anderberg, and J. Carrington, Strain-specific interaction of the Tobacco etch virus NIa protein with the translation initiation factor eIF4E in the yeast two-hybrid system, Virology, vol.273, pp.300-306, 2000.

M. C. Schaad and J. C. Carrington, Suppression of long-distance movement of Tobacco etch virus in a nonsusceptible host, J. Virol, vol.70, pp.2556-2561, 1996.

M. C. Schaad, A. D. Lellis, and J. C. Carrington, VPg of Tobacco etch potyvirus is a host genotype-specific determinant for long-distance movement, J Virol, vol.71, pp.8624-8631, 1997.

G. Scheper, B. V. Kollenburg, J. Hu, Y. Luo, D. Goss et al., Phosphorylation of eukaryotic initiation factor 4E markedly reduces its affinity for capped mRNA, J. Biol. Chem, vol.277, pp.3303-3309, 2002.

K. J. Schmid, S. Ramos-onsins, H. Ringys-beckstein, B. Weisshaar, and T. Mitchell-olds, A multilocus sequence survey in Arabidopsis thaliana reveals a genome-wide departure from a neutral model of DNA sequence polymorphism, Genetics, vol.169, pp.1601-1615, 2005.

K. J. Schmid, T. R. Sorensen, R. Stracke, O. Torjek, T. Altmann et al., Large-scale identification and analysis of genome-wide singlenucleotide polymorphisms for mapping in Arabidopsis thaliana, Genome Res, vol.13, pp.1250-1257, 2003.

D. C. Schwartz and R. Parker, mRNA decapping in yeast requires dissociation of the cap binding protein, eukaryotic translation initiation factor 4E, Mol Cell Biol, vol.20, pp.7933-7942, 2000.

S. R. Scofield, C. M. Tobias, J. P. Rathjen, J. H. Chang, D. T. Lavelle et al., Molecular basis of gene-for-gene specificity in bacterial speck disease of tomato, Science, vol.274, pp.2063-2065, 1996.

J. Shen, H. Araki, L. Chen, J. Q. Chen, and D. Tian, Unique evolutionary mechanism in R-genes under the presence/absence polymorphism in Arabidopsis thaliana, Genetics, vol.172, pp.1243-1250, 2006.

, GpppA)-bound human full-length eukaryotic initiation factor 4E: biological importance of the C-terminal flexible region, Biochem J, vol.362, issue.7, pp.539-544

K. Tomoo, X. Shen, K. Okabe, Y. Nozoe, S. Fukuhara et al., Structural features of human initiation factor 4E, studied by X-ray crystal analyses and molecular dynamics simulations, J Mol Biol, vol.328, pp.365-383, 2003.

I. Topisirovic, A. D. Capili, and K. L. Borden, Gamma interferon and cadmium treatments modulate eukaryotic initiation factor 4E-dependent mRNA transport of cyclin D1 in a PML-dependent manner, Mol. Cell Biol, vol.22, pp.6183-6198, 2002.

G. A. Tuskan, S. Difazio, S. Jansson, J. Bohlmann, I. Grigoriev et al., , vol.313, pp.1596-1604

H. Ueda, Y. Yamaguchi, and H. Sano, Direct interaction between the tobacco mosaic virus helicase domain and the ATP-bound resistance protein, N factor during the hypersensitive response in tobacco plants, Plant Mol Biol, vol.61, pp.31-45, 2006.

S. Urcuqui-inchima, A. L. Haenni, and F. Bernardi, Potyvirus proteins: a wealth of functions, Virus Res, vol.74, pp.157-175, 2001.

S. Vasilescu, M. Ptushkina, B. Linz, P. P. Muller, and J. E. Mccarthy, Mutants of eukaryotic initiation factor eIF-4E with altered mRNA cap binding specificity reprogram mRNA selection by ribosomes in Saccharomyces cerevisiae, J. Biol. Chem, vol.271, pp.7030-7037, 1996.

L. Volpon, M. J. Osborne, I. Topisirovic, N. Siddiqui, and K. L. Borden, Cap-free structure of eIF4E suggests a basis for conformational regulation by its ligands, Embo J, vol.25, pp.5138-5149, 2006.

M. Wakiyama, A. Suzuki, M. Saigoh, N. Sakai, H. Miyoshi et al., Analysis of the isoform of Xenopus euakryotic translation initiation factor 4E, Biosci. Biotechnol. Biochem, vol.65, pp.232-235, 2001.

J. Walsh and C. Jenner, Turnip mosaic virus and the quest for durable resistance, Mol. Plant Pathol, vol.3, pp.289-300, 2002.

M. Walter, C. Chaban, K. Schutze, O. Batistic, K. Weckermann et al., Visualization of protein interactions in living plant cells using bimolecular fluorescence complementation, Plant J, vol.40, pp.428-438, 2004.

X. Wang, Z. Ullah, and R. Grumet, Interaction between Zucchini mosaic potyvirus RNA-dependent RNA polymerase and host poly(A) binding protein, Virology, vol.275, pp.433-443, 2000.

G. A. Watterson, On the number of segregating sites in genetical models without recombination, Theor Popul Biol, vol.7, pp.256-276, 1975.

M. K. Weidman, R. Sharma, S. Raychaudhuri, P. Kundu, W. Tsai et al., The interaction of cytoplasmic RNA viruses with the nucleus, Virus Res, vol.95, pp.75-85, 2003.

S. Wittmann, H. Chatel, M. G. Fortin, and J. F. Laliberte, Interaction of the viral protein genome linked of Turnip mosaic potyvirus with the translational eukaryotic initiation factor (iso)4E of Arabidopsis thaliana using the yeast two-hybrid system, Virology, vol.234, pp.84-92, 1997.

S. I. Wright and B. S. Gaut, Molecular population genetics and the search for adaptive evolution in plants, Mol Biol Evol, vol.22, pp.506-519, 2005.

Z. Yang, R. Nielsen, N. Goldman, and A. M. Pedersen, Codon-substitution models for heterogeneous selection pressure at amino acid sites, Genetics, vol.155, pp.431-449, 2000.

I. Yeam, J. R. Cavatorta, D. R. Ripoll, B. C. Kang, and M. M. Jahn, Functional dissection of naturally occurring amino acid substitutions in eIF4E that confers recessive potyvirus resistance in plants, Plant Cell, 2007.

G. Yi, J. M. Lee, S. Lee, D. Choi, and B. D. Kim, Exploitation of pepper EST-SSRs and SSR-based linkage map, Theor Appl Genet, vol.114, pp.113-130, 2006.

M. Yoshii, M. Nishikiori, K. Tomita, N. Yoshioka, R. Kozuka et al., The Arabidopsis cucumovirus multiplication 1 and 2 loci encode translation initiation factors 4E and 4G, J Virol, vol.78, pp.6102-6111, 2004.

N. D. Young, The genetic architecture of resistance, Curr Opin Plant Biol, vol.3, pp.285-290, 2000.

T. Zhou, Y. Wang, J. Q. Chen, H. Araki, Z. Jing et al., Genome-wide identification of NBS genes in japonica rice reveals significant expansion of divergent non-TIR NBS-LRR genes, Mol Genet Genomics, vol.271, pp.402-415, 2004.

, At-eIF4E3 81 KSNQVIWGSSLRSLYTFGTIEEFWSLYNNIHPPTKWVSGADLYCFKDKIEPKWEDPICANGGKWSMMFPK---ATLECNW At-eIF4E1 76 KSKQTSWGSSLRPVFTFSTVEEFWSLYNNMKHPSKLAHGADFYCFKHIIEPKWEDPICANGGKWTMTFPK---EKSDKSW At-eIF(iso4E) 42 KG--AAWGASLRKAYTFDTVEDFWGLHETIFQTSKLTANAEIHLFKAGVEPKWEDPECANGGKWTWVVTANRKEALDKGW At-nCBP 59 GVRNQSYEDNIKKMVEFSTVEGFWACYCHLARSSLLPSPTDLHFFKDGIRPLWEDGANCNGGKWIIRFSK---VVSARFW consensus 81, At-eIF4E2, vol.81

*. *. ,

*. .. , * At-eIF4E2 158 LNTLLALVGEQFDQGDEICGAVLNFR--TRGDRISLWTKKAANEEAQLSIGKQWKELLGYNDTIGFIVHEDAKTLDRDAK At-eIF4E3 158 LNTLLALVGEQFDQGDEICGAVLNFR--ARGDRISLWTKNAANEEAQLSIGKQWKELLGYNETIGFIVHEDAKTLDRDAK At-eIF4E1, p.153

. At-eif, -R At-nCBP 136 EDLLLALVGDQLDDADNICGAVLSVR--FNEDIISVWNRNASDHQAVMGLRDSIKRHLKLPHAYVMEYKPHDASLRDNSS consensus 161, p.120

, At-eIF4E2 236 RRYTV---At-eIF4E3 236 RRYTV---At-eIF4E1 231 NAYTA---At-eIF(iso4E) 194 SRFTV---At-nCBP 214 YRNTWLRG consensus 241

, Sensibilisation des plaques : dépôt des anticorps dans les puits d'une plaque

, Fixation de l'antigène (protéines virales extraites des échantillons de feuilles broyés) aux anticorps

, Révélation : dépôt du substrat de la phosphatase alcaline (PNPP)

, S'il y a réaction antigène-anticorps, la phosphatase alcaline dégrade le substrat, ce qui se traduit par une réaction colorimétrique